Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
Protein automated matches [191063] (9 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188959] (1 PDB entry) |
Domain d3dxsx_: 3dxs X: [174335] automated match to d1fvqa_ complexed with li, zn |
PDB Entry: 3dxs (more details), 1.7 Å
SCOPe Domain Sequences for d3dxsx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxsx_ d.58.17.0 (X:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} mrkiqvgvtgmtcaacsnsveaalmnvngvfkasvallqnradvvfdpnlvkeedikeei edagfeaeilaeew
Timeline for d3dxsx_: