PDB entry 3ddt
View 3ddt on RCSB PDB site
Description: Crystal structure of the B2 box from MuRF1 in dimeric state
Class: ligase
Keywords: zinc-binding motif, RING-like fold, Coiled coil, Cytoplasm, Ligase, Metal-binding, Muscle protein, Nucleus, Polymorphism, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on
2008-06-06, released
2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase TRIM63
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ddta1, d3ddta2 - Chain 'B':
Compound: E3 ubiquitin-protein ligase TRIM63
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ddtb1, d3ddtb2 - Chain 'C':
Compound: E3 ubiquitin-protein ligase TRIM63
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ddtc_ - Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ddtA (A:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplqs
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3ddtB (B:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplqs
Sequence, based on observed residues (ATOM records): (download)
>3ddtB (B:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplq
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3ddtC (C:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplqs
Sequence, based on observed residues (ATOM records): (download)
>3ddtC (C:)
gshpmckehedekiniycltcevptcsmckvfgihkacevaplq