Lineage for d3ddtc_ (3ddt C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037487Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 3037488Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 3037489Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 3037512Protein automated matches [190972] (1 species)
    not a true protein
  7. 3037513Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries)
  8. 3037516Domain d3ddtc_: 3ddt C: [173849]
    Other proteins in same PDB: d3ddta2, d3ddtb2
    automated match to d2d8ua1
    complexed with zn

Details for d3ddtc_

PDB Entry: 3ddt (more details), 1.9 Å

PDB Description: Crystal structure of the B2 box from MuRF1 in dimeric state
PDB Compounds: (C:) E3 ubiquitin-protein ligase TRIM63

SCOPe Domain Sequences for d3ddtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddtc_ g.43.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshpmckehedekiniycltcevptcsmckvfgihkacevaplq

SCOPe Domain Coordinates for d3ddtc_:

Click to download the PDB-style file with coordinates for d3ddtc_.
(The format of our PDB-style files is described here.)

Timeline for d3ddtc_: