![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
![]() | Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) ![]() |
![]() | Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins) |
![]() | Protein automated matches [190972] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries) |
![]() | Domain d3ddta1: 3ddt A:1-45 [173847] Other proteins in same PDB: d3ddta2, d3ddtb2 automated match to d2d8ua1 complexed with zn |
PDB Entry: 3ddt (more details), 1.9 Å
SCOPe Domain Sequences for d3ddta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ddta1 g.43.1.1 (A:1-45) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshpmckehedekiniycltcevptcsmckvfgihkacevaplqs
Timeline for d3ddta1: