PDB entry 3car

View 3car on RCSB PDB site
Description: reduced structure of the acidic cytochrome c3 from desulfovibrio africanus
Class: electron transport
Keywords: cytochrome c3, tetraheme, reduced form, electron transport, desulfovibrio africanus
Deposited on 1998-11-17, released 2000-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio africanus [TaxId:873]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P94690 (1-102)
  Domains in SCOPe 2.06: d3cara_
• Heterogens: ZN, HEM, ARS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3carA (A:)
  xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs
  dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn