SCOPe 2.06: Domain d3cara_: 3car A:

Lineage for d3cara_ (3car A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio africanus [TaxId:873] [48701] (2 PDB entries)

8. Domain d3cara_: 3car A: [19662]
   complexed with ars, hem, zn

Details for d3cara_

PDB Entry: 3car, 1.9 Å

PDB Description: reduced structure of the acidic cytochrome c3 from desulfovibrio africanus

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d3cara_:

Sequence; same for both SEQRES and ATOM records:

>d3cara_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus [TaxId: 873]}
xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs
dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn

Timeline for d3cara_:

• d3cara_ first appeared (with stable ids) in SCOP 1.55
  
• d3cara_ appears in SCOPe 2.05
  
• d3cara_ appears in SCOPe 2.07
  
• d3cara_ appears in the current release, SCOPe 2.08