PDB entry 2wip

View 2wip on RCSB PDB site
Description: structure of cdk2-cyclin a complexed with 8-anilino-1-methyl-4,5-dihydro- 1h-pyrazolo[4,3-h] quinazoline-3-carboxylic acid
Class: transferase
Keywords: cell cycle, ATP-binding, transferase, phosphorylation, nucleotide-binding, serine/threonine-protein 2 kinase, serine/threonine-protein kinase, cell division, phosphoprotein, protein kinase, kinase, cyclin, nucleus, mitosis
Deposited on 2009-05-14, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WIP
    • Uniprot P24941 (5-302)
    Domains in SCOPe 2.07: d2wipa1, d2wipa2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WIP
    • Uniprot P20248 (Start-264)
    Domains in SCOPe 2.07: d2wipb1, d2wipb2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WIP
    • Uniprot P24941 (5-End)
    Domains in SCOPe 2.07: d2wipc1, d2wipc2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WIP
    • Uniprot P20248 (Start-264)
    Domains in SCOPe 2.07: d2wipd1, d2wipd2
  • Heterogens: P49, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wipA (A:)
    gplvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrlerphrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wipA (A:)
    plvdmenfqkvekigvvykarnkltgevvalkkirldtetegvpstaireisllkelnhp
    nivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchsh
    rvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyys
    tavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfp
    kwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wipB (B:)
    gplgsnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeykl
    qnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyt
    kkqvlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpy
    lkylpsviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqq
    sirekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wipB (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wipC (C:)
    gplvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrlerphrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wipC (C:)
    dmenfqkvekigvvykarnkltgevvalkkirldtetegvpstaireisllkelnhpniv
    klldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvl
    hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav
    diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa
    rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wipD (D:)
    gplgsnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeykl
    qnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyt
    kkqvlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpy
    lkylpsviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqq
    sirekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wipD (D:)
    yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
    yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetlnl