PDB entry 2qfp

View 2qfp on RCSB PDB site
Description: Crystal structure of red kidney bean purple acid phosphatase in complex with fluoride
Class: hydrolase
Keywords: binuclear, Fe-Zn, Hydrolase
Deposited on 2007-06-27, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfpa1, d2qfpa2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfpb1, d2qfpb2
  • Chain 'C':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfpc1, d2qfpc2
  • Chain 'D':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfpd1, d2qfpd2
  • Heterogens: FE, ZN, SO4, F, NAG, NA, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfpA (A:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfpB (B:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfpC (C:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfpD (D:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst