Lineage for d2qfpd2 (2qfp D:121-432)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2231923Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 2231948Protein automated matches [190524] (2 species)
    not a true protein
  7. 2231949Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (6 PDB entries)
  8. 2231967Domain d2qfpd2: 2qfp D:121-432 [150749]
    Other proteins in same PDB: d2qfpa1, d2qfpb1, d2qfpc1, d2qfpd1
    automated match to d1kbpa2
    complexed with f, fe, na, nag, ndg, so4, zn

Details for d2qfpd2

PDB Entry: 2qfp (more details), 2.2 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with fluoride
PDB Compounds: (D:) purple acid phosphatase

SCOPe Domain Sequences for d2qfpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfpd2 d.159.1.1 (D:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOPe Domain Coordinates for d2qfpd2:

Click to download the PDB-style file with coordinates for d2qfpd2.
(The format of our PDB-style files is described here.)

Timeline for d2qfpd2: