PDB entry 2q8w

View 2q8w on RCSB PDB site
Description: Crystal structure of PAP-S1aci, a pokeweed antiviral protein from seeds of Phytolacca acinosa
Class: hydrolase
Keywords: RIP fold, natural Asn-GlcNAc residues, HYDROLASE
Deposited on 2007-06-12, released 2008-06-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pokeweed antiviral protein
    Species: Phytolacca acinosa
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q8W (0-260)
    Domains in SCOPe 2.04: d2q8wa_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q8wA (A:)
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlilrrnnlyvmgysdpydnkcryhifndikgteysdventlcpstnprvakpinyng
lyptlenkagvtsrnqvqlgiqilssdigkisgqgsftekteakfllvaiqmvpeaarfk
yienqvktnfnrdffpndkvleleenwgkistaihdakngalpkplelknadgtkwivlr
vdeikpdvgllkyvngtcqtt