SCOPe 2.04: Domain d2q8wa_: 2q8w A:

Lineage for d2q8wa_ (2q8w A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Phytolacca acinosa [188469] (1 PDB entry)

8. Domain d2q8wa_: 2q8w A: [167480]
   automated match to d1gika_
   complexed with nag

Details for d2q8wa_

PDB Entry: 2q8w, 1.7 Å

PDB Description: crystal structure of pap-s1aci, a pokeweed antiviral protein from seeds of phytolacca acinosa

PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d2q8wa_:

Sequence; same for both SEQRES and ATOM records:

>d2q8wa_ d.165.1.1 (A:) automated matches {Phytolacca acinosa}
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlilrrnnlyvmgysdpydnkcryhifndikgteysdventlcpstnprvakpinyng
lyptlenkagvtsrnqvqlgiqilssdigkisgqgsftekteakfllvaiqmvpeaarfk
yienqvktnfnrdffpndkvleleenwgkistaihdakngalpkplelknadgtkwivlr
vdeikpdvgllkyvngtcqtt

Timeline for d2q8wa_:

• d2q8wa_ first appeared in SCOPe 2.01
  
• d2q8wa_ appears in SCOPe 2.03
  
• d2q8wa_ appears in SCOPe 2.05
  
• d2q8wa_ appears in the current release, SCOPe 2.08