PDB entry 2paa

View 2paa on RCSB PDB site
Description: Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg
Class: transferase
Keywords: transferase, phosphoglycerate kinase, enzyme-ligand complex
Deposited on 2007-03-27, released 2007-11-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase, testis specific
    Species: Mus musculus [TaxId:10090]
    Gene: Pgk2, Pgk-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09041 (Start-415)
      • see remark 999 (149)
    Domains in SCOPe 2.02: d2paaa_
  • Chain 'B':
    Compound: Phosphoglycerate kinase, testis specific
    Species: Mus musculus [TaxId:10090]
    Gene: Pgk2, Pgk-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09041 (Start-415)
      • see remark 999 (149)
    Domains in SCOPe 2.02: d2paab_
  • Heterogens: ATP, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2paaA (A:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2paaA (A:)
    akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
    grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
    hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
    asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
    lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
    sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
    ngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2paaB (B:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2paaB (B:)
    akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
    grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
    hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
    asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
    lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
    sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
    ngcvtiigkvshvstgggaslellegkilpgvealsnm