Lineage for d2paaa_ (2paa A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183841Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1183842Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1183843Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
  6. 1183875Protein automated matches [190709] (4 species)
    not a true protein
  7. 1183900Species Mouse (Mus musculus) [TaxId:10090] [188280] (3 PDB entries)
  8. 1183902Domain d2paaa_: 2paa A: [167097]
    automated match to d1kf0a_
    complexed with 3pg, atp

Details for d2paaa_

PDB Entry: 2paa (more details), 2.7 Å

PDB Description: crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg
PDB Compounds: (A:) Phosphoglycerate kinase, testis specific

SCOPe Domain Sequences for d2paaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2paaa_ c.86.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
ngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm

SCOPe Domain Coordinates for d2paaa_:

Click to download the PDB-style file with coordinates for d2paaa_.
(The format of our PDB-style files is described here.)

Timeline for d2paaa_: