PDB entry 2oip

View 2oip on RCSB PDB site
Description: Crystal Structure of the S290G Active Site Mutant of TS-DHFR from Cryptosporidium hominis
Class: transferase, oxidoreductase
Keywords: bifunctional enzyme, transferase, oxidoreductase
Deposited on 2007-01-11, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chain A, crystal structure of Dhfr
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CGA3 (0-518)
      • engineered (287)
    Domains in SCOPe 2.07: d2oipa1, d2oipa2
  • Chain 'B':
    Compound: Chain A, crystal structure of Dhfr
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CGA3 (0-518)
      • engineered (287)
    Domains in SCOPe 2.07: d2oipb1, d2oipb2
  • Chain 'C':
    Compound: Chain A, crystal structure of Dhfr
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CGA3 (0-518)
      • engineered (287)
    Domains in SCOPe 2.07: d2oipc1, d2oipc2
  • Chain 'D':
    Compound: Chain A, crystal structure of Dhfr
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CGA3 (0-518)
      • engineered (287)
    Domains in SCOPe 2.07: d2oipd1, d2oipd2
  • Chain 'E':
    Compound: Chain A, crystal structure of Dhfr
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CGA3 (0-518)
      • engineered (287)
    Domains in SCOPe 2.07: d2oipe1, d2oipe2
  • Heterogens: UMP, CB3, MTX, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oipA (A:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oipA (A:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkn
    cdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldlls
    rvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtng
    nhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgv
    dqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrsc
    dlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfp
    qlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oipB (B:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oipB (B:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkn
    cdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldlls
    rvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtng
    nhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgv
    dqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrsc
    dlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfp
    qlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oipC (C:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oipC (C:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekcd
    pargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrv
    lengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtngnh
    liekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdq
    laklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdl
    glgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpql
    kfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oipD (D:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oipD (D:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkc
    dpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsr
    vlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtngn
    hliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvd
    qlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscd
    lglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpq
    lkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oipE (E:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oipE (E:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    gqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlen
    gayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtngnhlie
    kkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlak
    lietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglg
    spfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfk
    rkveniedfkwedieligyypyptikmdmav