SCOPe 2.08: Domain d2oipc2: 2oip C:186-521

Lineage for d2oipc2 (2oip C:186-521)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)

8. Domain d2oipc2: 2oip C:186-521 [148789]
   Other proteins in same PDB: d2oipa1, d2oipb1, d2oipc1, d2oipd1, d2oipe1
   automated match to d1qzfa2
   complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipc2

PDB Entry: 2oip, 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis

PDB Compounds: (C:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipc2:

Sequence; same for both SEQRES and ATOM records:

>d2oipc2 d.117.1.1 (C:186-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
cdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldlls
rvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtng
nhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgv
dqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrsc
dlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfp
qlkfkrkveniedfkwedieligyypyptikmdmav

Timeline for d2oipc2:

• d2oipc2 first appeared in SCOP 1.75
  
• d2oipc2 appears in SCOPe 2.07