Lineage for d2oipc2 (2oip C:186-521)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536167Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2536168Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2536169Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2536512Protein automated matches [190469] (15 species)
    not a true protein
  7. 2536520Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)
  8. 2536530Domain d2oipc2: 2oip C:186-521 [148789]
    Other proteins in same PDB: d2oipa1, d2oipb1, d2oipc1, d2oipd1, d2oipe1
    automated match to d1qzfa2
    complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipc2

PDB Entry: 2oip (more details), 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (C:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oipc2 d.117.1.1 (C:186-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
cdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldlls
rvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtng
nhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgv
dqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrsc
dlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfp
qlkfkrkveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d2oipc2:

Click to download the PDB-style file with coordinates for d2oipc2.
(The format of our PDB-style files is described here.)

Timeline for d2oipc2: