Lineage for d2oipb1 (2oip B:3-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904155Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)
  8. 2904166Domain d2oipb1: 2oip B:3-180 [148786]
    Other proteins in same PDB: d2oipa2, d2oipb2, d2oipc2, d2oipd2, d2oipe2
    automated match to d2oipa1
    complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipb1

PDB Entry: 2oip (more details), 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (B:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oipb1 c.71.1.0 (B:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d2oipb1:

Click to download the PDB-style file with coordinates for d2oipb1.
(The format of our PDB-style files is described here.)

Timeline for d2oipb1: