PDB entry 2nm3

View 2nm3 on RCSB PDB site
Description: Crystal structure of dihydroneopterin aldolase from S. aureus in complex with (1S,2S)-monapterin at 1.68 angstrom resolution
Class: lyase
Keywords: Dihydroneopterin aldolase, dhna, substrate complex, monapterin, neopterin, 7,8-dihydromonapterin, drug design, LYASE
Deposited on 2006-10-20, released 2007-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.227
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroneopterin aldolase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nm3a_
  • Heterogens: ACT, MPU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nm3A (A:)
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k