SCOPe 2.07: Domain d2nm3a_: 2nm3 A:

Lineage for d2nm3a_ (2nm3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
   beta-sheets of four subunits form a barrel, closed: n=16, S=16
   automatically mapped to Pfam PF02152

6. Protein 7,8-dihydroneopterin aldolase [55629] (4 species)

7. Species Staphylococcus aureus [TaxId:1280] [55630] (13 PDB entries)
   Uniprot P56740

8. Domain d2nm3a_: 2nm3 A: [148290]
   automated match to d1dhna_
   complexed with act, mpu

Details for d2nm3a_

PDB Entry: 2nm3, 1.68 Å

PDB Description: Crystal structure of dihydroneopterin aldolase from S. aureus in complex with (1S,2S)-monapterin at 1.68 angstrom resolution

PDB Compounds: (A:) dihydroneopterin aldolase

SCOPe Domain Sequences for d2nm3a_:

Sequence; same for both SEQRES and ATOM records:

>d2nm3a_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus [TaxId: 1280]}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k

Timeline for d2nm3a_:

• d2nm3a_ first appeared in SCOP 1.75, called d2nm3a1
  
• d2nm3a_ appears in SCOPe 2.06
  
• d2nm3a_ appears in the current release, SCOPe 2.08