PDB entry 2mgz

View 2mgz on RCSB PDB site
Description: Solution structure of RBFOX family ASD-1 RRM and SUP-12 RRM in ternary complex with RNA
Class: RNA binding protein/RNA
Keywords: Solution Structure, Protein-RNA complex, Ternary Complex, RRM (RNA recognition motif), RNA BINDING PROTEIN-RNA complex
Deposited on 2013-11-12, released 2014-08-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein ASD-1, isoform a
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: asd-1, CELE_R74.5, R74.5
  Database cross-references and differences (RAF-indexed):
  • Uniprot G5EEW7 (1-93)
    • expression tag (0)
  Domains in SCOPe 2.08: d2mgza1, d2mgza2
• Chain 'B':
  Compound: Protein SUP-12, isoform a
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: sup-12, CELE_T22B2.4, T22B2.4
  Database cross-references and differences (RAF-indexed):
  • Uniprot O45189 (1-104)
    • expression tag (0)
  Domains in SCOPe 2.08: d2mgzb1, d2mgzb2
• Chain 'C':
  Compound: RNA (5'-r(*up*gp*cp*ap*up*gp*gp*up*gp*up*gp*c)-3')
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mgzA (A:)
  gdgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadra
  raefngttiegrrvevnlatqrvhnkkakplmsv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mgzB (B:)
  gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy
  gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvqla
  

  
  
• Chain 'C':
  No sequence available.