Lineage for d2mgzb1 (2mgz B:20-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952438Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258944] (3 PDB entries)
  8. 2952441Domain d2mgzb1: 2mgz B:20-123 [258945]
    Other proteins in same PDB: d2mgza1, d2mgza2, d2mgzb2
    automated match to d2cqda1
    protein/RNA complex

Details for d2mgzb1

PDB Entry: 2mgz (more details)

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna
PDB Compounds: (B:) Protein SUP-12, isoform a

SCOPe Domain Sequences for d2mgzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgzb1 d.58.7.1 (B:20-123) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
stnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgyg
fvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvqla

SCOPe Domain Coordinates for d2mgzb1:

Click to download the PDB-style file with coordinates for d2mgzb1.
(The format of our PDB-style files is described here.)

Timeline for d2mgzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mgzb2