PDB entry 2lxx

View 2lxx on RCSB PDB site
Description: Solution struture of cofilin like UNC-60B protein from Caenorhabditis elegans
Class: protein binding
Keywords: ADF/Cofilin fold, PROTEIN BINDING
Deposited on 2012-09-04, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-depolymerizing factor 2, isoform c
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: unc-60, C38C3.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lxxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lxxA (A:)
    masgvkvdpscknaydllhnkhqhsyiifkidkndtaivvekvgeknapyaefveemkkl
    vedgkecryaavdvevtvqrqgaegtstlnkvifvqycpdnapvrrrmlyassvralkas
    lgleslfqvqasemsdldeksvksdlmsnqri