SCOPe 2.06: Domain d2lxxa_: 2lxx A:

Lineage for d2lxxa_ (2lxx A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (12 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255468] (3 PDB entries)

8. Domain d2lxxa_: 2lxx A: [243031]
   automated match to d4keea_

Details for d2lxxa_

PDB Entry: 2lxx

PDB Description: solution structure of cofilin like unc-60b protein from caenorhabditis elegans

PDB Compounds: (A:) Actin-depolymerizing factor 2, isoform c

SCOPe Domain Sequences for d2lxxa_:

Sequence; same for both SEQRES and ATOM records:

>d2lxxa_ d.109.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
masgvkvdpscknaydllhnkhqhsyiifkidkndtaivvekvgeknapyaefveemkkl
vedgkecryaavdvevtvqrqgaegtstlnkvifvqycpdnapvrrrmlyassvralkas
lgleslfqvqasemsdldeksvksdlmsnqri

Timeline for d2lxxa_:

• d2lxxa_ first appeared in SCOPe 2.04
  
• d2lxxa_ appears in SCOPe 2.05
  
• d2lxxa_ appears in SCOPe 2.07
  
• d2lxxa_ appears in the current release, SCOPe 2.08