PDB entry 2l89

View 2l89 on RCSB PDB site
Description: Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA
Class: Protein binding
Keywords: Histone binding, Protein binding
Deposited on 2011-01-07, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PWWP domain-containing protein 1
  Species: Schizosaccharomyces pombe [TaxId:4896]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O59676 (0-107)
    • cloning artifact (106)
  Domains in SCOPe 2.06: d2l89a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l89A (A:)
  saddrlnfgdrilvkapgypwwpalllrrketkdslntnssfnvlykvlffpdfnfawvk
  rnsvkplldseiakflgsskrkskelieayeasktppdlkeesstdle