SCOPe 2.06: Domain d2l89a_: 2l89 A:

Lineage for d2l89a_ (2l89 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255413] (1 PDB entry)

8. Domain d2l89a_: 2l89 A: [242805]
   automated match to d1h3za_

Details for d2l89a_

PDB Entry: 2l89

PDB Description: Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA

PDB Compounds: (A:) PWWP domain-containing protein 1

SCOPe Domain Sequences for d2l89a_:

Sequence; same for both SEQRES and ATOM records:

>d2l89a_ b.34.9.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
saddrlnfgdrilvkapgypwwpalllrrketkdslntnssfnvlykvlffpdfnfawvk
rnsvkplldseiakflgsskrkskelieayeasktppdlkeesstdle

Timeline for d2l89a_:

• d2l89a_ first appeared in SCOPe 2.04
  
• d2l89a_ appears in SCOPe 2.05
  
• d2l89a_ appears in SCOPe 2.07
  
• d2l89a_ appears in the current release, SCOPe 2.08