PDB entry 2kyg

View 2kyg on RCSB PDB site
Description: Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to AML1-ETO activity
Class: protein binding
Keywords: protein/protein, homodimer bound to monomer, PROTEIN BINDING
Deposited on 2010-05-25, released 2010-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13861 (5-49)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2kyga1, d2kyga2
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13861 (5-49)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2kygb1, d2kygb2
  • Chain 'C':
    Compound: Protein CBFA2T1
    Species: Homo sapiens [TaxId:9606]
    Gene: RUNX1T1, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06455 (7-37)
      • expression tag (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kygA (A:)
    gamgsmshiqippgltellqgytvevlrqqppdlvefaveyftrlreara
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kygB (B:)
    gamgsmshiqippgltellqgytvevlrqqppdlvefaveyftrlreara
    

  • Chain 'C':
    No sequence available.