Lineage for d2kyga1 (2kyg A:-2-44)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993555Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 1993556Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 1993557Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 protein domains)
  6. 1993575Protein automated matches [190321] (3 species)
    not a true protein
  7. 1993576Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries)
  8. 1993579Domain d2kyga1: 2kyg A:-2-44 [242698]
    Other proteins in same PDB: d2kyga2, d2kygb2
    automated match to d2hwnb_

Details for d2kyga1

PDB Entry: 2kyg (more details)

PDB Description: Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to AML1-ETO activity
PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2kyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kyga1 a.31.1.1 (A:-2-44) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mshiqippgltellqgytvevlrqqppdlvefaveyftrlreara

SCOPe Domain Coordinates for d2kyga1:

Click to download the PDB-style file with coordinates for d2kyga1.
(The format of our PDB-style files is described here.)

Timeline for d2kyga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kyga2