| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) ![]() dimer of identical alpha-hairpin motifs |
| Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
| Protein automated matches [190321] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries) |
| Domain d2kygb1: 2kyg B:-2-44 [242699] Other proteins in same PDB: d2kyga2, d2kygb2 automated match to d2hwnb_ |
PDB Entry: 2kyg (more details)
SCOPe Domain Sequences for d2kygb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kygb1 a.31.1.1 (B:-2-44) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mshiqippgltellqgytvevlrqqppdlvefaveyftrlreara
Timeline for d2kygb1: