SCOPe 2.08: Domain d2kygb1: 2kyg B:-2-44

Lineage for d2kygb1 (2kyg B:-2-44)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries)

8. Domain d2kygb1: 2kyg B:-2-44 [242699]
   Other proteins in same PDB: d2kyga2, d2kygb2
   automated match to d2hwnb_

Details for d2kygb1

PDB Entry: 2kyg

PDB Description: structure of the aml1-eto nervy domain - pka(riia) complex and its contribution to aml1-eto activity

PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2kygb1:

Sequence; same for both SEQRES and ATOM records:

>d2kygb1 a.31.1.1 (B:-2-44) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mshiqippgltellqgytvevlrqqppdlvefaveyftrlreara

Timeline for d2kygb1:

• d2kygb1 first appeared in SCOPe 2.04, called d2kygb_
  
• d2kygb1 appears in SCOPe 2.07