PDB entry 2kmd

View 2kmd on RCSB PDB site
Description: Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to co-activator CBP
Class: transcription, protein binding
Keywords: pnt domain, sam domain, ets-1, mapk phosphorylation, phosphoprotein, proto-oncogene, transcription, transcription regulation, protein binding, conformational dynamics
Deposited on 2009-07-27, released 2010-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein C-ets-1
  Species: Mus musculus [TaxId:10090]
  Gene: Ets1, Ets-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27577 (3-112)
    • expression tag (2)
  Domains in SCOPe 2.04: d2kmda_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2kmdA (A:)
  gshmecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwav
  nefslkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2kmdA (A:)
  hmecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavne
  fslkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk