SCOPe 2.04: Domain d2kmda_: 2kmd A:

Lineage for d2kmda_ (2kmd A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein automated matches [254583] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255359] (1 PDB entry)

8. Domain d2kmda_: 2kmd A: [242564]
   automated match to d2jv3a_

Details for d2kmda_

PDB Entry: 2kmd

PDB Description: Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to co-activator CBP

PDB Compounds: (A:) Protein C-ets-1

SCOPe Domain Sequences for d2kmda_:

Sequence; same for both SEQRES and ATOM records:

>d2kmda_ a.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hmecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavne
fslkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk

Timeline for d2kmda_:

• d2kmda_ is new in SCOPe 2.04-stable
  
• d2kmda_ appears in SCOPe 2.05
  
• d2kmda_ appears in the current release, SCOPe 2.08, called d2kmda1