PDB entry 2k2c

View 2k2c on RCSB PDB site
Description: Solution NMR structure of N-terminal domain of human pirh2. Northeast Structural Genomics Consortium (NESG) target HT2A
Class: metal binding protein
Keywords: zinc-binding protein, Cytoplasm, Metal-binding, Nucleus, Zinc-finger, METAL BINDING PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2008-03-31, released 2008-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RING finger and CHY zinc finger domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RCHY1, ARNIP, CHIMP, PIRH2, RNF199, ZNF363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96PM5 (0-136)
      • variant (10)
      • variant (12)
    Domains in SCOPe 2.08: d2k2ca1, d2k2ca2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k2cA (A:)
    maataredgatgeergqrgcehydrgcllkapccdklytcrlchdnnedhqldrfkvkev
    qcincekiqhaqqtceecstlfgeyycdichlfdkdkkqyhcencgicrigpkedffhcl
    kcnlclamnlqgrhkci