Lineage for d2k2ca1 (2k2c A:1-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038928Fold g.89: CHY zinc finger-like [161218] (1 superfamily)
    trimetal-bound fold; integration of HIT/MYND-like and rubredoxin-like fingers
  4. 3038929Superfamily g.89.1: CHY zinc finger-like [161219] (1 family) (S)
  5. 3038930Family g.89.1.1: CHY zinc finger [161220] (2 proteins)
    Pfam PF05495
  6. 3038934Protein automated matches [254569] (1 species)
    not a true protein
  7. 3038935Species Human (Homo sapiens) [TaxId:9606] [255315] (1 PDB entry)
  8. 3038936Domain d2k2ca1: 2k2c A:1-82 [242357]
    Other proteins in same PDB: d2k2ca2
    automated match to d2dkta1
    complexed with zn

Details for d2k2ca1

PDB Entry: 2k2c (more details)

PDB Description: solution nmr structure of n-terminal domain of human pirh2. northeast structural genomics consortium (nesg) target ht2a
PDB Compounds: (A:) RING finger and CHY zinc finger domain-containing protein 1

SCOPe Domain Sequences for d2k2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k2ca1 g.89.1.1 (A:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maataredgatgeergqrgcehydrgcllkapccdklytcrlchdnnedhqldrfkvkev
qcincekiqhaqqtceecstlf

SCOPe Domain Coordinates for d2k2ca1:

Click to download the PDB-style file with coordinates for d2k2ca1.
(The format of our PDB-style files is described here.)

Timeline for d2k2ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k2ca2