![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.89: CHY zinc finger-like [161218] (1 superfamily) trimetal-bound fold; integration of HIT/MYND-like and rubredoxin-like fingers |
![]() | Superfamily g.89.1: CHY zinc finger-like [161219] (1 family) ![]() |
![]() | Family g.89.1.1: CHY zinc finger [161220] (2 proteins) Pfam PF05495 |
![]() | Protein automated matches [254569] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255315] (1 PDB entry) |
![]() | Domain d2k2ca1: 2k2c A:1-82 [242357] Other proteins in same PDB: d2k2ca2 automated match to d2dkta1 complexed with zn |
PDB Entry: 2k2c (more details)
SCOPe Domain Sequences for d2k2ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k2ca1 g.89.1.1 (A:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]} maataredgatgeergqrgcehydrgcllkapccdklytcrlchdnnedhqldrfkvkev qcincekiqhaqqtceecstlf
Timeline for d2k2ca1: