Lineage for d2k2ca2 (2k2c A:83-137)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038966Fold g.93: Zinc hairpin stack [161244] (1 superfamily)
    stack of beta-hairpins; in the middle hairpins, there is HCxxCxxC motif, the first and the last residues of which contribute to the zinc-binding site on one side of hairpin, whereas the middle residues contribute to the zinc-binding site on the other side
  4. 3038967Superfamily g.93.1: Zinc hairpin stack [161245] (2 families) (S)
  5. 3038972Family g.93.1.0: automated matches [254250] (1 protein)
    not a true family
  6. 3038973Protein automated matches [254570] (1 species)
    not a true protein
  7. 3038974Species Human (Homo sapiens) [TaxId:9606] [255316] (1 PDB entry)
  8. 3038975Domain d2k2ca2: 2k2c A:83-137 [242358]
    Other proteins in same PDB: d2k2ca1
    automated match to d2dkta2
    complexed with zn

Details for d2k2ca2

PDB Entry: 2k2c (more details)

PDB Description: solution nmr structure of n-terminal domain of human pirh2. northeast structural genomics consortium (nesg) target ht2a
PDB Compounds: (A:) RING finger and CHY zinc finger domain-containing protein 1

SCOPe Domain Sequences for d2k2ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k2ca2 g.93.1.0 (A:83-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geyycdichlfdkdkkqyhcencgicrigpkedffhclkcnlclamnlqgrhkci

SCOPe Domain Coordinates for d2k2ca2:

Click to download the PDB-style file with coordinates for d2k2ca2.
(The format of our PDB-style files is described here.)

Timeline for d2k2ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k2ca1