PDB entry 2ju7

View 2ju7 on RCSB PDB site
Description: Solution-State Structures of Oleate-Liganded LFABP, Protein Only
Class: lipid binding protein
Keywords: protein, apo, LFABP, iLBP, FABP, Acetylation, Cytoplasm, Lipid-binding, Phosphorylation, Transport, LIPID BINDING PROTEIN
Deposited on 2007-08-15, released 2007-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, liver
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FABP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ju7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ju7A (A:)
mnfsgkyqvqsqenfepfmkamglpedliqkgkdikgvseivhegkkvkltitygskvih
neftlgeeceletmtgekvkavvkmegdnkmvttfkgiksvtefngdtitntmtlgdivy
krvskri