SCOPe 2.06: Domain d2ju7a_: 2ju7 A:

Lineage for d2ju7a_ (2ju7 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50867] (4 PDB entries)

8. Domain d2ju7a_: 2ju7 A: [148210]
   automated match to d1lfoa_

Details for d2ju7a_

PDB Entry: 2ju7

PDB Description: solution-state structures of oleate-liganded lfabp, protein only

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d2ju7a_:

Sequence; same for both SEQRES and ATOM records:

>d2ju7a_ b.60.1.2 (A:) Liver fatty acid binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnfsgkyqvqsqenfepfmkamglpedliqkgkdikgvseivhegkkvkltitygskvih
neftlgeeceletmtgekvkavvkmegdnkmvttfkgiksvtefngdtitntmtlgdivy
krvskri

Timeline for d2ju7a_:

• d2ju7a_ first appeared in SCOP 1.75, called d2ju7a1
  
• d2ju7a_ appears in SCOPe 2.05
  
• d2ju7a_ appears in SCOPe 2.07
  
• d2ju7a_ appears in the current release, SCOPe 2.08