PDB entry 2jo0

View 2jo0 on RCSB PDB site
Description: The solution structure of the monomeric species of the C terminal domain of the CA protein of HIV-1
Class: viral protein
Keywords: hiv, monomer, capsid protein, viral protein
Deposited on 2007-02-17, released 2007-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (1-86)
      • expression tag (0)
      • engineered (39)
    Domains in SCOPe 2.04: d2jo0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jo0A (A:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknamtetllvqnanpdcktilka
    lgpaatleemmtacqgvggpghkarvl