PDB entry 2jn4

View 2jn4 on RCSB PDB site
Description: Solution NMR Structure of Protein RP4601 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium Target RpT2; Ontario Center for Structural Proteomics Target RP4601.
Class: structural genomics, unknown function
Keywords: hypothetical protein, Rhodopseudomonas palustris, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-12-22, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein fixU, nifT
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: fixU/ nifT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jn4a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jn4A (A:)
mgsshhhhhhssgrenlyfqgmkvmirktatghsayvakkdleelivemenpalwggkvt
langwqlelpamaadtplpitvearkl

    Sequence, based on observed residues (ATOM records): (download) 
    >2jn4A (A:)
mkvmirktatghsayvakkdleelivemenpalwggkvtlangwqlelpamaadtplpit
vearkl