Lineage for d2jn4a1 (2jn4 A:1-66)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434378Fold b.173: NifT/FixU barrel-like [159202] (1 superfamily)
    barrel, closed, n=6, S=10; meander
  4. 2434379Superfamily b.173.1: NifT/FixU-like [159203] (1 family) (S)
    automatically mapped to Pfam PF06988
  5. 2434380Family b.173.1.1: NifT/FixU [159204] (1 protein)
    Pfam PF06988
  6. 2434381Protein Uncharacterized protein FixU (NifT) [159205] (1 species)
  7. 2434382Species Rhodopseudomonas palustris [TaxId:1076] [159206] (1 PDB entry)
    Uniprot Q6N0Y6 1-66
  8. 2434383Domain d2jn4a1: 2jn4 A:1-66 [148143]

Details for d2jn4a1

PDB Entry: 2jn4 (more details)

PDB Description: solution nmr structure of protein rp4601 from rhodopseudomonas palustris. northeast structural genomics consortium target rpt2; ontario center for structural proteomics target rp4601.
PDB Compounds: (A:) Hypothetical protein fixU, nifT

SCOPe Domain Sequences for d2jn4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jn4a1 b.173.1.1 (A:1-66) Uncharacterized protein FixU (NifT) {Rhodopseudomonas palustris [TaxId: 1076]}
mkvmirktatghsayvakkdleelivemenpalwggkvtlangwqlelpamaadtplpit
vearkl

SCOPe Domain Coordinates for d2jn4a1:

Click to download the PDB-style file with coordinates for d2jn4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jn4a1: