PDB entry 2jg9

View 2jg9 on RCSB PDB site
Description: crystallographic structure of human c1q globular heads (p1)
Class: immune system
Keywords: polymorphism, glycoprotein, phagocytosis, disease mutation, complement pathway, immune system, cell surface molecule, pyrrolidone carboxylic acid, hydroxylation, innate immunity, immune response, collagen, tolerance, apopotosis, complement
Deposited on 2007-02-09, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c1q subcomponent subunit a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg9a1
  • Chain 'B':
    Compound: complement c1q subcomponent subunit b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg9b1
  • Chain 'C':
    Compound: complement c1q subcomponent subunit c
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg9c1
  • Chain 'D':
    Compound: complement c1q subcomponent subunit a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg9d1
  • Chain 'E':
    Compound: complement c1q subcomponent subunit b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg9e1
  • Chain 'F':
    Compound: complement c1q subcomponent subunit c
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg9f1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jg9A (A:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jg9B (B:)
    atqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassr
    gnlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmeg
    ansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg9B (B:)
    tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
    nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
    nsifsgfllfpdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jg9C (C:)
    kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
    tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
    svfsgfllfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg9C (C:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jg9D (D:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jg9E (E:)
    atqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassr
    gnlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmeg
    ansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg9E (E:)
    tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
    nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
    nsifsgfllfpdm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jg9F (F:)
    kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
    tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
    svfsgfllfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg9F (F:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd