Lineage for d2jg9f1 (2jg9 F:89-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777239Protein Complement c1q globular head, C chain [101617] (1 species)
    hetrotrimer of A, B and C chains
  7. 2777240Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries)
  8. 2777247Domain d2jg9f1: 2jg9 F:89-217 [148050]
    Other proteins in same PDB: d2jg9a1, d2jg9b1, d2jg9d1, d2jg9e1
    automatically matched to d1pk6c_
    complexed with ca

Details for d2jg9f1

PDB Entry: 2jg9 (more details), 1.9 Å

PDB Description: crystallographic structure of human c1q globular heads (p1)
PDB Compounds: (F:) complement c1q subcomponent subunit c

SCOPe Domain Sequences for d2jg9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg9f1 b.22.1.1 (F:89-217) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd

SCOPe Domain Coordinates for d2jg9f1:

Click to download the PDB-style file with coordinates for d2jg9f1.
(The format of our PDB-style files is described here.)

Timeline for d2jg9f1: