Lineage for d2jg9a1 (2jg9 A:90-222)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777219Protein Complement c1q globular head, A chain [101613] (1 species)
    hetrotrimer of A, B and C chains
  7. 2777220Species Human (Homo sapiens) [TaxId:9606] [101614] (6 PDB entries)
  8. 2777226Domain d2jg9a1: 2jg9 A:90-222 [148045]
    Other proteins in same PDB: d2jg9b1, d2jg9c1, d2jg9e1, d2jg9f1
    automatically matched to d1pk6a_
    complexed with ca

Details for d2jg9a1

PDB Entry: 2jg9 (more details), 1.9 Å

PDB Description: crystallographic structure of human c1q globular heads (p1)
PDB Compounds: (A:) complement c1q subcomponent subunit a

SCOPe Domain Sequences for d2jg9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg9a1 b.22.1.1 (A:90-222) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifps

SCOPe Domain Coordinates for d2jg9a1:

Click to download the PDB-style file with coordinates for d2jg9a1.
(The format of our PDB-style files is described here.)

Timeline for d2jg9a1: