PDB entry 2j2z

View 2j2z on RCSB PDB site
Description: x-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
Class: chaperone/surface active protein
Keywords: chaperone/surface active protein, periplasmic, pilus termination, immunoglobulin domain, paph, papd, fimbria, chaperone, p5 pocket, chaperone/ surface active protein complex
Deposited on 2006-08-17, released 2006-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2086
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein papd
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j2za1, d2j2za2
  • Chain 'B':
    Compound: pap fimbrial minor pilin protein
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j2zb1
  • Heterogens: SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j2zA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2zA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j2zB (B:)
    gpfpppgmslpeywgeehvwwdgraafhgevvrpactlamedawqiidmgetpvrdlqng
    fsgperkfslrlrncefnsqggnlfsdsrirvtfdgvrgetpdkfnlsgqakginlqiad
    vrgniaragkvmpaipltgneealdytlrivrngkkleagnyfavlgfrvdye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2zB (B:)
    raafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggn
    lfsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaipltgneea
    ldytlrivrngkkleagnyfavlgfrvdye