Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
Protein PAP fimbrial minor pilin protein PapH [158924] (1 species) |
Species Escherichia coli [TaxId:562] [158925] (3 PDB entries) Uniprot P07111 46-195 |
Domain d2j2zb1: 2j2z B:24-173 [145642] Other proteins in same PDB: d2j2za1, d2j2za2 complexed with co, so4 |
PDB Entry: 2j2z (more details), 2.3 Å
SCOPe Domain Sequences for d2j2zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2zb1 b.2.3.2 (B:24-173) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]} raafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggn lfsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaipltgneea ldytlrivrngkkleagnyfavlgfrvdye
Timeline for d2j2zb1: