Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
Species Escherichia coli [TaxId:562] [49357] (15 PDB entries) |
Domain d2j2za1: 2j2z A:1-124 [137974] Other proteins in same PDB: d2j2za2, d2j2zb1 automated match to d1pdka1 complexed with co, so4 |
PDB Entry: 2j2z (more details), 2.3 Å
SCOPe Domain Sequences for d2j2za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2za1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
Timeline for d2j2za1: