PDB entry 2iw6

View 2iw6 on RCSB PDB site
Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
Class: cell cycle
Keywords: phosphorylation, nucleotide-binding, serine/threonine-protein kinase, cell cycle complex, kinase, mitosis, cell cycle, transferase, ATP-binding
Deposited on 2006-06-26, released 2006-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
      • engineered mutation (92)
    Domains in SCOPe 2.06: d2iw6a1, d2iw6a2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iw6b1, d2iw6b2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
      • engineered mutation (92)
    Domains in SCOPe 2.06: d2iw6c2, d2iw6c3
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iw6d1, d2iw6d2
  • Heterogens: QQ2, SGM, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iw6A (A:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw6A (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnhpn
    ivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchshr
    vlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyyst
    avdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpk
    warqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iw6B (B:)
    mevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw6B (B:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    agaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekykn
    skyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iw6C (C:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw6C (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iw6D (D:)
    mevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw6D (D:)
    yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
    yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetlnl