SCOPe 2.06: Domain d2iw6d1: 2iw6 D:178-309

Lineage for d2iw6d1 (2iw6 D:178-309)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d2iw6d1: 2iw6 D:178-309 [137742]
   Other proteins in same PDB: d2iw6a1, d2iw6a2, d2iw6c2, d2iw6c3
   automated match to d1oiub1
   complexed with mg, qq2, sgm

Details for d2iw6d1

PDB Entry: 2iw6, 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2iw6d1:

Sequence; same for both SEQRES and ATOM records:

>d2iw6d1 a.74.1.1 (D:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
vlkvltfdlaap

Timeline for d2iw6d1:

• d2iw6d1 first appeared in SCOP 1.73
  
• d2iw6d1 appears in SCOPe 2.05
  
• d2iw6d1 appears in SCOPe 2.07
  
• d2iw6d1 appears in the current release, SCOPe 2.08