PDB entry 2hp4

View 2hp4 on RCSB PDB site
Description: Computational design and crystal structure of an enhanced affinity mutant human CD8-alpha-alpha co-receptor
Class: immune system
Keywords: CD8, Co-receptor, Soluble protein, KD, Protein engineering, Immunotherapy, Immune-suppressor, IMMUNE SYSTEM
Deposited on 2006-07-17, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01732 (0-113)
      • engineered (32)
      • engineered (52)
    Domains in SCOPe 2.08: d2hp4a_
  • Chain 'B':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01732 (0-113)
      • engineered (32)
      • engineered (52)
    Domains in SCOPe 2.08: d2hp4b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hp4A (A:)
    sqfrvspldrtwnlgetvelkcqvllsnptsgaswlfqprgaaasptfllylnqnkpkaa
    egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hp4B (B:)
    sqfrvspldrtwnlgetvelkcqvllsnptsgaswlfqprgaaasptfllylnqnkpkaa
    egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa