PDB entry 2hp4
View 2hp4 on RCSB PDB site
Description: Computational design and crystal structure of an enhanced affinity mutant human CD8-alpha-alpha co-receptor
Class: immune system
Keywords: CD8, Co-receptor, Soluble protein, KD, Protein engineering, Immunotherapy, Immune-suppressor, IMMUNE SYSTEM
Deposited on
2006-07-17, released
2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: T-cell surface glycoprotein CD8 alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01732 (0-113)
- engineered (32)
- engineered (52)
Domains in SCOPe 2.08: d2hp4a_ - Chain 'B':
Compound: T-cell surface glycoprotein CD8 alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01732 (0-113)
- engineered (32)
- engineered (52)
Domains in SCOPe 2.08: d2hp4b_ - Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2hp4A (A:)
sqfrvspldrtwnlgetvelkcqvllsnptsgaswlfqprgaaasptfllylnqnkpkaa
egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2hp4B (B:)
sqfrvspldrtwnlgetvelkcqvllsnptsgaswlfqprgaaasptfllylnqnkpkaa
egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa