Lineage for d2hp4a_ (2hp4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742322Domain d2hp4a_: 2hp4 A: [165191]
    automated match to d1akjd_
    complexed with gol, so4; mutant

Details for d2hp4a_

PDB Entry: 2hp4 (more details), 2.1 Å

PDB Description: computational design and crystal structure of an enhanced affinity mutant human cd8-alpha-alpha co-receptor
PDB Compounds: (A:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d2hp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hp4a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqfrvspldrtwnlgetvelkcqvllsnptsgaswlfqprgaaasptfllylnqnkpkaa
egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa

SCOPe Domain Coordinates for d2hp4a_:

Click to download the PDB-style file with coordinates for d2hp4a_.
(The format of our PDB-style files is described here.)

Timeline for d2hp4a_: