SCOPe 2.08: Domain d2hp4b_: 2hp4 B:

Lineage for d2hp4b_ (2hp4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d2hp4b_: 2hp4 B: [165192]
   automated match to d1akjd_
   complexed with gol, so4; mutant

Details for d2hp4b_

PDB Entry: 2hp4, 2.1 Å

PDB Description: computational design and crystal structure of an enhanced affinity mutant human cd8-alpha-alpha co-receptor

PDB Compounds: (B:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d2hp4b_:

Sequence; same for both SEQRES and ATOM records:

>d2hp4b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqfrvspldrtwnlgetvelkcqvllsnptsgaswlfqprgaaasptfllylnqnkpkaa
egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa

Timeline for d2hp4b_:

• d2hp4b_ first appeared in SCOPe 2.01
  
• d2hp4b_ appears in SCOPe 2.07