PDB entry 2hl5
View 2hl5 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued)
Class: structural protein
Keywords: microtubule binding, dynactin, cytoskeleton associated protein, p150Glued, EB1, +TIP protein Complex structure, structural protein
Deposited on
2006-07-06, released
2006-09-12
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.212
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Microtubule-associated protein RP/EB family member 1
Species: Homo sapiens [TaxId:9606]
Gene: MAPRE1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2hl5a_ - Chain 'B':
Compound: Microtubule-associated protein RP/EB family member 1
Species: Homo sapiens [TaxId:9606]
Gene: MAPRE1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2hl5b_ - Chain 'C':
Compound: Dynactin-1
Species: Homo sapiens [TaxId:9606]
Gene: DCTN1
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Dynactin-1
Species: Homo sapiens [TaxId:9606]
Gene: DCTN1
Database cross-references and differences (RAF-indexed):
- Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2hl5A (A:)
gsdeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
tdegfvipdeggpqeeqeey
Sequence, based on observed residues (ATOM records): (download)
>2hl5A (A:)
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2hl5B (B:)
gsdeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
tdegfvipdeggpqeeqeey
Sequence, based on observed residues (ATOM records): (download)
>2hl5B (B:)
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatdeg
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.