Lineage for d2hl5b_ (2hl5 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1102477Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 1102478Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 1102479Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 1102480Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 1102481Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 1102488Domain d2hl5b_: 2hl5 B: [136560]
    automated match to d1yiga1
    complexed with cl; mutant

Details for d2hl5b_

PDB Entry: 2hl5 (more details), 1.93 Å

PDB Description: crystal structure of the c-terminal domain of human eb1 in complex with the a49m mutant cap-gly domain of human dynactin-1 (p150-glued)
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d2hl5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hl5b_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatdeg

SCOPe Domain Coordinates for d2hl5b_:

Click to download the PDB-style file with coordinates for d2hl5b_.
(The format of our PDB-style files is described here.)

Timeline for d2hl5b_: